Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Elongation of very long chain fatty acids protein 3(Elovl3)

Recombinant Mouse Elongation of very long chain fatty acids protein 3(Elovl3)

SKU:CSB-CF007621MO

Regular price €1.560,95 EUR
Regular price Sale price €1.560,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:O35949

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDTSMNFSRGLKMDLMQPYDFETFQDLRPFLEEYWVSSFLIVVVYLLLIVVGQTYMRTRK SFSLQRPLILWSFFLAIFSILGTLRMWKFMATVMFTVGLKQTVCFAIYTDDAVVRFWSFL FLLSKVVELGDTAFIILRKRPLIFVHWYHHSTVLLFTSFGYKNKVPSGGWFMTMNFGVHS VMYTYYTMKAAKLKHPNLLPMVITSLQILQMVLGTIFGILNYIWRQEKGCHTTTEHFFWS FMLYGTYFILFAHFFHRAYLRPKGKVASKSQ

Protein Names:Recommended name: Elongation of very long chain fatty acids protein 3 EC= 2.3.1.n8 Alternative name(s): 3-keto acyl-CoA synthase Elovl3 CIN-2 Cold-inducible glycoprotein of 30 kDa ELOVL fatty acid elongase 3 Short name= E

Gene Names:Name:Elovl3 Synonyms:Cig30

Expression Region:1-271

Sequence Info:Full length protein

View full details