GeneBio Systems
Recombinant Mouse Cornifin-A (Sprr1a)
Recombinant Mouse Cornifin-A (Sprr1a)
SKU:Q62266
Couldn't load pickup availability
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Neuroscience
Uniprot ID: Q62266
Gene Names: Sprr1a
Alternative Name(s): Small proline-rich protein 1A;SPR1 A;SPR1A
Abbreviation: Recombinant Mouse Sprr1a protein
Organism: Mus musculus (Mouse)
Source: Yeast
Expression Region: 1-144aa
Protein Length: Full Length
Tag Info: C-terminal 6xHis-tagged
Target Protein Sequence: MSSHQQKQPCTVPPQLHQQQVKQPCQPPPQEPCAPKTKDPCHPVPEPCNPKGPEPCHPKAPEPCHPKAPEPCNPKVPEPCQPKVPEPCQPKVPEPCNPKVPEPCQPKAPEPCHPKAPEPCHPVVPEPCPSTVTPSPYQQKTKQK
MW: 16.6 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane. May participate widely in the construction of cell envelopes in cornifying epithelia characterized by either increased thickness or a requirement for extreme flexibility.
Reference:
Function:
