Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Cathepsin L1(Ctsl1),partial

Recombinant Mouse Cathepsin L1(Ctsl1),partial

SKU:CSB-EP006193MO

Regular price €380,95 EUR
Regular price Sale price €380,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:20ug. Other sizes are also available. For further information, please contact us.

Research Areas:Signal Transduction

Uniprot ID:P06797

Gene Names:Ctsl

Organism:Mus musculus (Mouse)

AA Sequence:IPKSVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGT

Expression Region:114-288aa

Sequence Info:Partial

Source:E.coli

Tag Info:N-terminal 6xHis-taggedand C-terminal Myc-tagged

MW:26.2 kDa

Alternative Name(s):Cathepsin L (Major excreted protein) (MEP) (p39 cysteine proteinase) (Ctsl1)

Relevance:Important for the overall degradation of proteins in lysosomes.

Reference:"High throughput quantitative glycomics and glycoform-focused proteomics of murine dermis and epidermis." Uematsu R., Furukawa J., Nakagawa H., Shinohara Y., Deguchi K., Monde K., Nishimura S. Mol. Cell. Proteomics 4:1977-1989(2005)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:Important for the overall degradation of proteins in lysosomes.

Involvement in disease:

Subcellular Location:Lysosome

Protein Families:Peptidase C1 family

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Mm&CID=471755

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?mmu:13039

STRING Database Link:https://string-db.org/network/10090.ENSMUSP00000021933

OMIM Database Link:

Lead Time Guidance:3-7 business days

View full details