Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Brain protein I3(Bri3)

Recombinant Mouse Brain protein I3(Bri3)

SKU:CSB-CF002811MO

Regular price €1.406,95 EUR
Regular price Sale price €1.406,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P28662

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDHKPLLQERPPAYNLEAGQGDYACGPHGYGAIPTAPPPPPYPYLVTGIPTSHPRVYNIH SRTVTRYPANSIVVVGGCPVCRVGVLEYCFTCLGIFLAIVLFPFGFLCCFALRKRRCPNC GAVFT

Protein Names:Recommended name: Brain protein I3

Gene Names:Name:Bri3

Expression Region:1-125

Sequence Info:Full length protein

View full details