Gene Bio Systems
Recombinant Mouse Bone morphogenetic protein 8B(Bmp8b)
Recombinant Mouse Bone morphogenetic protein 8B(Bmp8b)
SKU:CSB-EP002746MO
Couldn't load pickup availability
Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Signal Transduction
Uniprot ID:P55105
Gene Names:Bmp8b
Organism:Mus musculus (Mouse)
AA Sequence:TARPLKKKQLNQINQLPHSNKHLGILDDGHGSHGREVCRRHELYVSFRDLGWLDSVIAPQGYSAYYCAGECIYPLNSCMNSTNHATMQALVHLMKPDIIPKVCCVPTELSAISLLYYDRNNNVILRRERNMVVQACGCH
Expression Region:261-399aa
Sequence Info:Full Length of Mature Protein
Source:E.coli
Tag Info:N-terminal 6xHis-SUMO-tagged
MW:28.7 kDa
Alternative Name(s):BMP-8B
Relevance:Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis. Involved in the generation of primordial germ cells; this function involves Bmp4 in a synergistic manner though separate receptor complexes seem to be involved. Required for the initiation and maintenance of spermatogenesis. Signaling protein involved in regulation of thermogenesis and energy balance. Proposed to increase the peripheral response of brown adipose tissue to adrenergic stimulation while acting centrally in the hypothalamus to increase sympathetic output to BAT.
Reference:"Cooperation of endoderm-derived BMP2 and extraembryonic ectoderm-derived BMP4 in primordial germ cell generation in the mouse." Ying Y., Zhao G.Q. Dev. Biol. 232:484-492(2001)
Purity:Greater than 90% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis (By similarity). Involved in the generation of primordial germ cells; this function involves Bmp4 in a synergistic manner though separate receptor complexes seem to be involved. Required for the initiation and maintenance of spermatogenesis. Signaling protein involved in regulation of thermogenesis and energy balance. Proposed to increase the peripheral response of brown adipose tissue (BAT) to adrenergic stimulation while acting centrally in the hypothalamus to increase sympathetic output to BAT.
Involvement in disease:
Subcellular Location:Secreted
Protein Families:TGF-beta family
Tissue Specificity:Expressed in testis. Expressed in decidual cells of the uterus and in trophoblast cells of the labyrinthine region of the placenta and in the inner root sheath of hair follicles of early postnatal skin. Expressed in the extraembryonic ectoderm in pregastrula and gastrula stage mouse embryos. Expressed in brown adipose tissue and brain.
Paythway:
HGNC Database Link:
UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Mm&CID=439764
KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?mmu:12164
STRING Database Link:https://string-db.org/network/10090.ENSMUSP00000002457
OMIM Database Link:
Lead Time Guidance:13-23 business days
