Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse B-cell antigen receptor complex-associated protein beta chain(Cd79b)

Recombinant Mouse B-cell antigen receptor complex-associated protein beta chain(Cd79b)

SKU:CSB-CF004958MO

Regular price €1.483,95 EUR
Regular price Sale price €1.483,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P15530

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:VPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKDGIILIQTLLIILFIIVPIFLLLDKDDGKAGMEEDHTYEGLNIDQTATYEDIVTLRTGEVKWSVGEHPGQE

Protein Names:Recommended name: B-cell antigen receptor complex-associated protein beta chain Alternative name(s): B-cell-specific glycoprotein B29 Ig-beta Immunoglobulin-associated B29 protein CD_antigen= CD79b

Gene Names:Name:Cd79b Synonyms:Igb

Expression Region:26-228

Sequence Info:full length protein

View full details