Recombinant Mouse Apoptosis regulator Bcl-2(Bcl2),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Mouse Apoptosis regulator Bcl-2(Bcl2),partial

CSB-EP002611MO
Regular price
€783,95 EUR
Sale price
€783,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: Others

Target / Protein: Bcl2

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Mus musculus (Mouse)

Delivery time: 3-7 business days

Uniprot ID: P10417

AA Sequence: GRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRP

Tag info: N-terminal 6xHis-tagged

Expression Region: 5-205aa

Protein length: Partial

MW: 26.7 kDa

Alternative Name(s):

Relevance: Suppresses apoptosis in a variety of cell systs including factor-dependent lymphohatopoietic and neural cells. Regulates cell death by controlling the mitochondrial mbrane permeability. Appears to function in a feedback loop syst with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1).

Reference: Apoptosis factor EI24/PIG8 is a novel endoplasmic reticulum-localized Bcl-2-binding protein which is associated with suppression of breast cancer invasiveness.Zhao X., Ayer R.E., Davis S.L., Ames S.J., Florence B., Torchinsky C., Liou J.S., Shen L., Spanjaard R.A.Cancer Res. 65:2125-2129(2005)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Mouse Apoptosis regulator Bcl-2(Bcl2),partial
    Regular price
    €783,95 EUR
    Sale price
    €783,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Apoptosis regulator Bcl-2(BCL2),partial
    Regular price
    €557,95 EUR
    Sale price
    €557,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Bcl-2-like protein 1(BCL2L1),partial
    Regular price
    €612,95 EUR
    Sale price
    €612,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Bcl2 Antibody - Cat. #: CSB-PA002611LA01MO
    Regular price
    €322,95 EUR
    Sale price
    €322,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share