Skip to product information
1 of 1

GeneBio Systems

Recombinant Mouse 1-acyl-sn-glycerol-3-phosphate acyltransferase beta (Agpat2)-Detergent

Recombinant Mouse 1-acyl-sn-glycerol-3-phosphate acyltransferase beta (Agpat2)-Detergent

SKU:Q8K3K7

Regular price €3.460,95 EUR
Regular price Sale price €3.460,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Cancer

Uniprot ID: Q8K3K7

Gene Names: Agpat2

Alternative Name(s): 1-acylglycerol-3-phosphate O-acyltransferase 2;1-AGP acyltransferase 2;1-AGPAT 2;Lysophosphatidic acid acyltransferase beta;LPAAT-beta

Abbreviation: Recombinant Mouse Agpat2 protein-Detergent

Organism: Mus musculus (Mouse)

Source: Mammalian cell

Expression Region: 24-278aa

Protein Length: Full Length of Mature Protein

Tag Info: N-terminal 10xHis-tagged and C-terminal Twin-Strep-tagged

Target Protein Sequence: ARFYAKVGLYCVLCLSFSAAASIVCLLRHGGRTVDNMSIISWFVRSFKYVYGLRFEVSGQKKLEVDGPCVIISNHQSILDMMGLMEILPKRCVQIAKRELMFTGPVGLIMYLGGVYFINRQQARTAMSVMADLGDLMVKENLKVWIYPEGTRNDNGDLLPFKKGAFYLAIQAQVPIIPVVYSSFSSFYNVKTKLFTSGTIKVQVLDAVPTNGLTDADVTKLVDTCYQSMRATFLQISQIPQENSAIKEPGVLPAQ

MW: 32.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid

Buffer: 50 mM HEPES, 0.15 M NaCl, 0.05% DDM, 0.01% CHS, pH7.5

Reconstitution: /

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Converts 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) into 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by incorporating an acyl moiety at the sn-2 position of the glycerol backbone.

Reference:

Function:

View full details