Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mortierella alpina Cytochrome b5

Recombinant Mortierella alpina Cytochrome b5

SKU:CSB-CF897598MUM

Regular price €1.402,95 EUR
Regular price Sale price €1.402,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mortierella alpina (Mortierella renispora)

Uniprot NO.:Q9Y706

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAELKSFTLADLSQHTTKDSLYLAIHGKVYDCTGFIDEHPGGEEVLIDEAGRDATESFED VGHSDEARDIMSKLLVGEFKTDSSEKPKAKSPSSSTPRPIPAAEPSDSGSLQYVLALAVV AGCVIWKVLL

Protein Names:Recommended name: Cytochrome b5

Gene Names:

Expression Region:1-130

Sequence Info:full length protein

View full details