Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methylocella silvestris Large-conductance mechanosensitive channel(mscL)

Recombinant Methylocella silvestris Large-conductance mechanosensitive channel(mscL)

SKU:CSB-CF491144MTF

Regular price €1.263,95 EUR
Regular price Sale price €1.263,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906)

Uniprot NO.:B8EJ45

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLKEFKEFALRGNLIDLAIGFIIGAAFSGLVQSVVNDIIMPIVGRITGGVDFSNLYWQLS GAPQPTLALARQAGATIAYGNFITLLINFLIVAFVLFLAVKALNKVTPKPDPASTQPPKQ EVLLEQIRDLLARK

Protein Names:Recommended name: Large-conductance mechanosensitive channel

Gene Names:Name:mscL Ordered Locus Names:Msil_3652

Expression Region:1-134

Sequence Info:full length protein

View full details