Gene Bio Systems
Recombinant Methanothermobacter thermautotrophicus Uncharacterized protein MTH_1706 (MTH_1706)
Recombinant Methanothermobacter thermautotrophicus Uncharacterized protein MTH_1706 (MTH_1706)
SKU:CSB-CF517996MSR
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum)
Uniprot NO.:O27741
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNARDKKFMTAGIIIALIIAVLAPFLASPNPDGLESTAEKVMPNPETEPVLESPLPDYTL PALGDSPFGGVVSMVIGTILVLAIAYGVGAVFRGRKAAGEEGGEE
Protein Names:Recommended name: Uncharacterized protein MTH_1706
Gene Names:Ordered Locus Names:MTH_1706
Expression Region:1-105
Sequence Info:full length protein
