Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methanosphaerula palustris UPF0290 protein Mpal_2361 (Mpal_2361)

Recombinant Methanosphaerula palustris UPF0290 protein Mpal_2361 (Mpal_2361)

SKU:CSB-CF488709MSP

Regular price €1.452,95 EUR
Regular price Sale price €1.452,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)

Uniprot NO.:B8GEE2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLPAYLPNPAAALFGGGTPIDGGRRWSDGRRLLGDGKTWRGLVLGILSGVLLGLIQVSVQ DACVFVWLPRHTVLSVLLLAVGALAGDMVKSFVKRRIGKERGAAWPLADQYDLVAGSLLL LLIGDYGFAAVNLTIPVIFWILVLTPLLHRAVNLIGYAIGVKDVPW

Protein Names:Recommended name: UPF0290 protein Mpal_2361

Gene Names:Ordered Locus Names:Mpal_2361

Expression Region:1-166

Sequence Info:full length protein

View full details