Gene Bio Systems
Recombinant Methanosarcina barkeri Putative cobalt transport protein CbiM 1(cbiM1)
Recombinant Methanosarcina barkeri Putative cobalt transport protein CbiM 1(cbiM1)
SKU:CSB-CF670525MSM
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Methanosarcina barkeri (strain Fusaro / DSM 804)
Uniprot NO.:Q46D59
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MHIFEGFLPGPWWQIWWILSIPVFAYGIFRLNKLVKEKPEVLPLIAVSGAVIFVLSSLKL PSVTGSTSHPTGTGMAVILFGPAITSVLSAIVLLYQALFLAHGGITTFGANLMSMGIIGP FVAYAIYKTMMRLNVNFYVSAFVTATLADWVTYVVTSTQLALAFPANPGGVEGSLVAFLS VFAITQIPLAILEASLITLLFKYVLQAKGDLMVRLDVLTDSQVRKLKETKA
Protein Names:Recommended name: Putative cobalt transport protein CbiM 1 Alternative name(s): Energy-coupling factor transporter probable substrate-capture protein CbiM 1 Short name= ECF transporter S component CbiM 1
Gene Names:Name:cbiM1 Ordered Locus Names:Mbar_A1216
Expression Region:1-231
Sequence Info:full length protein
