Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methanocorpusculum labreanum UPF0290 protein Mlab_0318 (Mlab_0318)

Recombinant Methanocorpusculum labreanum UPF0290 protein Mlab_0318 (Mlab_0318)

SKU:CSB-CF385989MNT

Regular price €1.464,95 EUR
Regular price Sale price €1.464,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)

Uniprot NO.:A2SQ88

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIPAYIPNPAAALLGGGTPVDFGKCAKDGRRILGDGKTWRGLIGGIVVGIIFGLMQIFLY NYFNLEFLPKQTIITVCALATGALLGDMVKSYFKRRLGKDRGAKWPIADMYDMVVGSLVL MTLALLVTGNLNWFTENFDSVGFLIATIIAILILSPLLHRGTNIIGYLLGLKDVPW

Protein Names:Recommended name: UPF0290 protein Mlab_0318

Gene Names:Ordered Locus Names:Mlab_0318

Expression Region:1-176

Sequence Info:full length protein

View full details