Gene Bio Systems
Recombinant Methanococcoides burtonii UPF0290 protein Mbur_1051(Mbur_1051)
Recombinant Methanococcoides burtonii UPF0290 protein Mbur_1051(Mbur_1051)
SKU:CSB-CF623765MRY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Methanococcoides burtonii (strain DSM 6242)
Uniprot NO.:Q12X42
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLPAYLPNPFAALFGGGRPIDNGKTMSDGRRILGDGKTYRGFFVGLIFGALAGLMQMQLL EKYPVLFGVELPTFGTGGSNTTILIFALAVGSLFGDMFMSFFKRRMGLKRGAPLPVIDQL DFVLGALIFAYLASPVWFAEQFTFKVIAVILIITPLLHLATNVVGYFIGVKKEPW
Protein Names:Recommended name: UPF0290 protein Mbur_1051
Gene Names:Ordered Locus Names:Mbur_1051
Expression Region:1-175
Sequence Info:full length protein
