Recombinant Methanocaldococcus jannaschii Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A(ehaA)

SKU: CSB-CF688062MRU

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Uniprot NO.:Q57948

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVYNNSLLVRVMDIIILYLIALITSVIVALVLKLPIIPKEKPIRFSFETSIIFPTPILAL GIEAIFRNLFGDYISLAFFAGLFGALLSKYADKLFGEP

Protein Names:Recommended name: Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A

Gene Names:Name:ehaA Ordered Locus Names:MJ0528

Expression Region:1-98

Sequence Info:full length protein