Recombinant Mesocricetus auratus Interleukin-4 (Il4)

SKU: A0A1U7QAD7

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: A0A1U7QAD7

Gene Names: Il4

Alternative Name(s): (IL-4)(B-cell stimulatory factor 1)(Lymphocyte stimulatory factor 1)

Abbreviation: Recombinant Mesocricetus auratus Il4 protein

Organism: Mesocricetus auratus (Golden hamster)

Source: E.coli

Expression Region: 25-147aa

Protein Length: Full Length of Mature Protein

Tag Info: N-terminal 6xHis-tagged and C-terminal Strep II-tagged

Target Protein Sequence: CHHGALKEIIHILNQVTEKGTPCTEMVVPDALSARKNSTEKDLICRASQVLRKFYFQHEVTLCLKNNSRVLKDLKKLYRGISSLFPQKSCNVNESTYTTLKDFLESLRRIMQKKYWQCGSSTF

MW: 16.3 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes.

Reference: 1 RefSeq Submitted (APR-2022) to UniProtKB Cited for: IDENTIFICATION.

Function: