Skip to product information
1 of 1

GeneBio Systems

Recombinant Mesocricetus auratus Angiotensin-converting enzyme (Ace2), partial

Recombinant Mesocricetus auratus Angiotensin-converting enzyme (Ace2), partial

SKU:A0A1U7QTA1

Regular price €1.722,95 EUR
Regular price Sale price €1.722,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: A0A1U7QTA1

Gene Names: Ace2

Alternative Name(s):

Abbreviation: Recombinant Mesocricetus auratus Ace2 protein, partial

Organism: Mesocricetus auratus (Golden hamster)

Source: Baculovirus

Expression Region: 20-604aa

Protein Length: Partial

Tag Info: N-terminal 10xHis-tagged and C-terminal Strep II-tagged

Target Protein Sequence: IIEEQAKTFLDKFNQEAEDLSYQSALASWNYNTNITEENAQKMNEAAAKWSAFYEEQSKLAKNYSLQEVQNLTIKRQLQALQQSGSSALSADKNKQLNTILNTMSTIYSTGKVCNPKNPQECLLLEPGLDDIMATSTDYNERLWAWEGWRAEVGKQLRPLYEEYVVLKNEMARANNYEDYGDYWRGDYEAEGADGYNYNGNQLIEDVERTFKEIKPLYEQLHAYVRTKLMNTYPSYISPTGCLPAHLLGDMWGRFWTNLYPLTVPFGQKPNIDVTDAMVNQGWNAERIFKEAEKFFVSVGLPYMTQGFWENSMLTDPGDDRKVVCHPTAWDLGKGDFRIKMCTKVTMDNFLTAHHEMGHIQYDMAYATQPFLLRNGANEGFHEAVGEIMSLSAATPEHLKSIGLLPSDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGDIPKEQWMEKWWEMKREIVGVVEPLPHDETYCDPAALFHVSNDYSFIRYYTRTIYQFQFQEALCQAAKHDGPLHKCDISNSTEAGQKLLNMLRLGKSEPWTLALENVVGARNMDVRPLLNYFEPLSVWLKEQNKNSFV

MW: 70.3 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance:

Reference:

Function:

View full details