Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mesocricetus auratus Androgen-dependent TFPI-regulating protein(ADTRP)

Recombinant Mesocricetus auratus Androgen-dependent TFPI-regulating protein(ADTRP)

SKU:CSB-CF730631MRG

Regular price €1.509,95 EUR
Regular price Sale price €1.509,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mesocricetus auratus (Golden hamster)

Uniprot NO.:Q60534

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTRTTTCVYHFLVWNWYIFLNYYIPLIGKDDEKLKEFHDGGRSKYLTLLNLLLQAIFFGV ACLDDVLKRIIGRKDIKFITSTRDLLFSTLVFPISTFIFLVFWTLFYYDRSLIYPKGLDD YFPAWLNHAMHTYILLFVLVETILRPHHYPSKKLGLALLGACNLAYITRVLWRYSQTGNW VYPVFASLNPLGIIIFFLVCYILNASIYLVGEKINHWKWGATVKPLMKKKK

Protein Names:Recommended name: Androgen-dependent TFPI-regulating protein Alternative name(s): Androgen-dependent-expressed protein FAR-17a

Gene Names:Name:ADTRP

Expression Region:1-231

Sequence Info:full length protein

View full details