Skip to product information
1 of 1

Gene Bio Systems

Recombinant Meriones unguiculatus Beta-3 adrenergic receptor(ADRB3)

Recombinant Meriones unguiculatus Beta-3 adrenergic receptor(ADRB3)

SKU:CSB-CF001393MRA

Regular price €1.450,95 EUR
Regular price Sale price €1.450,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Meriones unguiculatus (Mongolian jird) (Mongolian gerbil)

Uniprot NO.:O70432

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RVGADAEAQECHSNPRCCSFASNMPYALLSSSVSFYLPLLVMLFVYARVFVVAKRQRRLL RRELGRFPPEESPRSPSRSPSPVAGGTGEAPDGVPSCGRRPARLLPLREHRALRTLGLIM GIFSLCWLPFFLANVLRALAGPSIVPNGVFIALNWLGYANSAFNPLI

Protein Names:Recommended name: Beta-3 adrenergic receptor Alternative name(s): Beta-3 adrenoreceptor Short name= Beta-3 adrenoceptor

Gene Names:Name:ADRB3

Expression Region:1-167

Sequence Info:full length protein

View full details