Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mannheimia haemolytica Leukotoxin(lktA),partial

Recombinant Mannheimia haemolytica Leukotoxin(lktA),partial

SKU:CSB-EP346605ESE

Regular price €1.022,95 EUR
Regular price Sale price €1.022,95 EUR
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Others

Target / Protein: lktA

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Mannheimia haemolytica (Pasteurella haemolytica)

Delivery time: 3-7 business days

Uniprot ID: P55118

AA Sequence: MGNKLTNISTNLKSSWLTAKSGLNRTGQSLAKAGQSLKTGAKKIILYIPKDYQYDTEKGNGLQDLVKAAEELGIEVQKEEGNDIAKAQTSLGTIQNVLGLTERGIVLSAPQLDKLLQKTKVGQAIGSAENLTKGFSNAKTVLSGIQSILGSVLAGMDLDEALQKNSNELTLAKAGLELTNSLIENIANSVKTLDAFGDQINQLGSKLQNVKGLSSLGDKLKGLSGFDKT

Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-229aa

Protein length: Partial

MW: 29.2 kDa

Alternative Name(s):

Relevance: Pasteurella leukotoxins are exotoxins that attack host leukocytes and especially polymorphonuclear cells, by causing cell rupture. The leukotoxin binds to the host LFA-1 integrin and induces a signaling cascade leading to many biological effects, including tyrosine phosphorylation of the CD18 tail, elevation of the intracellular Ca2+ and lysis of the host cell. This leukotoxin is a major contributor to the pathogenesis of lung injury in ovine pneumonic pasteurellosis. It has also weak hemolytic activity

Reference: "Molecular analysis of the leukotoxin determinants from Pasteurella haemolytica serotypes 1 to 16." Burrows L.L., Olah-Winfield E., Lo R.Y.C. Infect. Immun. 61:5001-5007(1993)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details