Gene Bio Systems
Recombinant Manduca sexta ATP synthase lipid-binding protein, mitochondrial
Recombinant Manduca sexta ATP synthase lipid-binding protein, mitochondrial
SKU:CSB-CF886978MPV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)
Uniprot NO.:Q9U505
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:DIDSAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAM GLFCLMMAFLLLFAF
Protein Names:Recommended name: ATP synthase lipid-binding protein, mitochondrial Alternative name(s): ATPase protein 9 ATPase subunit c
Gene Names:
Expression Region:57-131
Sequence Info:full length protein
