Gene Bio Systems
Recombinant Magnetospirillum magneticum UPF0060 membrane protein amb1014(amb1014)
Recombinant Magnetospirillum magneticum UPF0060 membrane protein amb1014(amb1014)
SKU:CSB-CF647338MAAS
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)
Uniprot NO.:Q2W8K7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MWAIPTYLLAAFAEIGGCFAFWAWLRLGKSPFWLAPGMASLALFAWALTRVDADFAGRAY AAYGGIYILSSLVWMWAVEESPPDRWDVLGAAFCLAGALVIIFAPRGE
Protein Names:Recommended name: UPF0060 membrane protein amb1014
Gene Names:Ordered Locus Names:amb1014
Expression Region:1-108
Sequence Info:full length protein
