
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171228
Research areas: Cell Biology
Target / Protein: GHR
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Macaca mulatta (Rhesus macaque)
Delivery time: 3-7 business days
Uniprot ID: P79194
AA Sequence: FSGSEPTAAILSRASWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDAVHHGSKSLGPIQLFYTRRNIQGQTQEWKECPDYVSAGENSCYFNSSFTSVWIPYCIKLTSNGDTVDGKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADILVRWEAPPNADIQKGWMVLEYELQYKEVNETKWKMMDPILSTSVPVYSLKVDKEYEVLVRSKRRNSRNYGEFSEVLYVTLPQMNQFTCEEDFY
Tag info: C-terminal 6xHis-tagged
Expression Region: 19-264aa
Protein length: Partial
MW: 30.2 kDa
Alternative Name(s): Somatotropin receptor
Relevance: Receptor for pituitary gland growth hormone involved in regulating postnatal body growth. On ligand binding, couples to, and activates the JAK2/STAT5 pathway The soluble form (GHBP) acts as a reservoir of growth hormone in plasma and may be a modulator/inhibitor of GH signaling.
Reference: "Monkey growth hormone (GH) receptor gene expression. Evidence for two mechanisms for the generation of the GH binding protein." Martini J.-F., Pezet A., Guezennec C.Y., Edery M., Postel-Vinay M.-C., Kelly P.A. J. Biol. Chem. 272:18951-18958(1997)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Macaca mulatta Growth hormone receptor(GHR),partial
- Regular price
- €637,95 EUR
- Sale price
- €637,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Pig Growth hormone receptor(GHR),partial
- Regular price
- €637,95 EUR
- Sale price
- €637,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Growth hormone receptor(GHR),partial
- Regular price
- €498,95 EUR
- Sale price
- €498,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Growth hormone receptor(GHR),partial
- Regular price
- €498,95 EUR
- Sale price
- €498,95 EUR
- Regular price
-
- Unit price
- per
Sold out