Skip to product information
1 of 1

GeneBio Systems

Recombinant Macaca fascicularis Tumor necrosis factor receptor superfamily member 13B, partial (Active)

Recombinant Macaca fascicularis Tumor necrosis factor receptor superfamily member 13B, partial (Active)

SKU:G7PTR7

Regular price €332,95 EUR
Regular price Sale price €332,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Cancer

Uniprot ID: G7PTR7

Gene Names: TNFRSF13B

Alternative Name(s): Tumor necrosis factor receptor superfamily member 13B; Transmembrane activator and CAML interactor; EGM_07468

Abbreviation: Recombinant Cynomolgus monkey TNFRSF13B protein, partial (Active)

Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Source: Mammalian cell

Expression Region: 2-160aa

Protein Length: Partial

Tag Info: C-terminal 10xHis-tagged

Target Protein Sequence: SGLGRSRRGGRSRVDQEERSPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKAICNHQSQRTCATFCRSLNCRKEQGRFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGSEHRGSEASPALPGLKLSADQL

MW: 19.2 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: ①Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B at 2 μg/mL can bind Macaca fascicularis TNFSF13B protein (CSB-MP6724MOV). The EC50 is 7.254-13.83 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B at 2 μg/mL can bind Human TNFSF13 protein (CSB-MP023989HU). The EC50 is 11.13-18.97 ng/mL. ③Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B at 2 μg/mL can bind Human TNFSF13B protein (CSB-MP897523HU1). The EC50 is 10.67-12.46 ng/mL. ④Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B at 2 μg/mL can bind Human TNFSF13B protein (CSB-MP897523HU1-B). The EC50 is 0.6374-1.431 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Receptor for TNFSF13/APRIL and TNFSF13B/TALL1/BAFF/BLYS that binds both ligands with similar high affinity. Mediates calcineurin-dependent activation of NF-AT, as well as activation of NF-kappa-B and AP-1. Involved in the stimulation of B- and T-cell function and the regulation of humoral immunity.

Reference: Genome sequencing and comparison of two nonhuman primate animal models, the cynomolgus and Chinese rhesus macaques. Yan G., Zhang G., Fang X., Zhang Y., Li C., Ling F., Cooper D.N., Li Q., Li Y., Wang J. Nat. Biotechnol. 29: 1019-1023 (2011)

Function:

View full details