Skip to product information
1 of 1

Gene Bio Systems

Recombinant Macaca fascicularis PRA1 family protein 3(ARL6IP5)

Recombinant Macaca fascicularis PRA1 family protein 3(ARL6IP5)

SKU:CSB-CF700139MOV

Regular price €1.476,95 EUR
Regular price Sale price €1.476,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Uniprot NO.:Q4R4R4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDVNIAPLRAWDDFFPGSDRFAQPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISVVGF LSPFNMILGGIVVVLVFTGFVWAAHNKDALRRLKKRYPTTFVMVVMLASYFLISMFGGVM VFVFGITFPLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLT DYISKVKE

Protein Names:Recommended name: PRA1 family protein 3 Alternative name(s): ADP-ribosylation factor-like protein 6-interacting protein 5 Short name= ARL-6-interacting protein 5 Short name= Aip-5

Gene Names:Name:ARL6IP5 Synonyms:PRAF3 ORF Names:QnpA-10140

Expression Region:1-188

Sequence Info:full length protein

View full details