Skip to product information
1 of 1

GeneBio Systems

Recombinant Macaca fascicularis Glucagon-like peptide 1 receptor (GLP1R), partial (Active)

Recombinant Macaca fascicularis Glucagon-like peptide 1 receptor (GLP1R), partial (Active)

SKU:F8V479

Regular price €519,95 EUR
Regular price Sale price €519,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Cardiovascular

Uniprot ID: F8V479

Gene Names: GLP1R

Alternative Name(s): Glucagon-like peptide 1 receptor; GLP1R

Abbreviation: Recombinant Cynomolgus monkey GLP1R protein, partial (Active)

Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Source: Mammalian cell

Expression Region: 24-144aa

Protein Length: Partial

Tag Info: C-terminal 10xHis-tagged

Target Protein Sequence: RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERNSPEEQLLSL

MW: 15.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis GLP1R at 2 μg/mL can bind Anti-GLP1R recombinant antibody (CSB-RA009514MA2HU). The EC50 is 1.292-1.518 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: /

Reference: /

Function:

View full details