
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Neuroscience
Uniprot ID: Q2PFW6
Gene Names: SNCG
Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
AA Sequence: MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKENVVHSVTSVAEKTKEQANAVSEAVVSSVNTVAAKTVEEAENIAVTSGVVRKEDLKPSAPQQEGEAAKEKEEVAEEAQSGGD
Expression Region: 1-127aa
Sequence Info: Full Length
Source: E.coli
Tag Info: NO-tagged
MW: 13.3 kDa
Alternative Name(s):
Relevance: Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases (By similarity). May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway
Reference: "Analysis of gene expression in cynomolgus monkey tissues by macaque cDNA oligo-chips." Kobayashi M., Tanuma R., Hirata M., Osada N., Kusuda J., Sugano S., Hashimoto K. Submitted (JUL-2005)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Macaca fascicularis Alpha-synuclein(SNCA)
- Regular price
- €915,95 EUR
- Sale price
- €915,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Macaca fascicularis Alpha-synuclein(SNCA)
- Regular price
- €1.004,95 EUR
- Sale price
- €1.004,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Macaca fascicularis Chymase(CMA1)
- Regular price
- €915,95 EUR
- Sale price
- €915,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Macaca fascicularis T-cell surface glycoprotein CD3 gamma chain(CD3G),partial
- Regular price
- €1.005,95 EUR
- Sale price
- €1.005,95 EUR
- Regular price
-
- Unit price
- per
Sold out