GeneBio Systems
Recombinant Macaca fascicularis Folate receptor alpha (FOLR1), partial (Active)
Recombinant Macaca fascicularis Folate receptor alpha (FOLR1), partial (Active)
SKU:A0A2K5U044
Couldn't load pickup availability
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Others
Uniprot ID: A0A2K5U044
Gene Names: FOLR1
Alternative Name(s):
Abbreviation: Recombinant Cynomolgus monkey FOLR1 protein, partial (Active)
Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source: Mammalian cell
Expression Region: 25-233aa
Protein Length: Partial
Tag Info: C-terminal 10xHis-tagged
Target Protein Sequence: RTARARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWKKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCPVGAACQPFHFYFPTPTVLCNEIWTYSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAM
MW: 26.0 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus FOLR1 at 2 μg/mL can bind Anti-FOLR1 recombinant antibody(CSB-RA008784MA1HU). The EC50 is 2.900-3.544 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance:
Reference: Warren W., Wilson R.K. Submitted to EMBL/GenBank/DDBJ databases (MAR-2013)
Function:
