Recombinant Macaca fascicularis B- and T-lymphocyte attenuator (BTLA), partial (Active)

SKU: A0A2K5W7M7

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Cancer

Uniprot ID: A0A2K5W7M7

Gene Names: BTLA

Alternative Name(s): B- and T-lymphocyte attenuator; B- and T-lymphocyte-associated protein; BTLA

Abbreviation: Recombinant Cynomolgus monkey BTLA protein, partial (Active)

Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Source: Mammalian cell

Expression Region: 31-152aa

Protein Length: Partial

Tag Info: C-terminal 10xHis-tagged

Target Protein Sequence: KESCDVQLYIKRQSYHSIFAGDPFKLECPVKYCAHRPQVTWCKLNGTTCVKLEGRHTSWKQEKNLSFFILHFEPVLPSDNGSYRCSANFLSAIIESHSTTLYVTDVKSASERPSKDEMASRP

MW: 15.3 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis BTLA at 2 μg/mL can bind Anti-BTLA recombinant antibody(CSB-RA773799MA1HU). The EC50 is 24.78-31.87 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Inhibitory receptor on lymphocytes that negatively regulates antigen receptor signaling via PTPN6/SHP-1 and PTPN11/SHP-2. May interact in cis (on the same cell) or in trans (on other cells) with TNFRSF14. In cis interactions, appears to play an immune regulatory role inhibiting in trans interactions in naive T cells to maintain a resting state. In trans interactions, can predominate during adaptive immune response to provide survival signals to effector T cells.

Reference: /

Function: