Gene Bio Systems
Recombinant Loxosceles amazonica Phospholipase D LamSicTox-alphaIC1
Recombinant Loxosceles amazonica Phospholipase D LamSicTox-alphaIC1
SKU:CSB-EP495649LQU
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: C0JAZ9
Gene Names: N/A
Organism: Loxosceles amazonica (Recluse spider)
AA Sequence: WIMGHMVNNINQIEEFVSLGANSIETDVSFDKKANPEYTYHGTPCDCGRDCLRWEYFKDFLNGLRKATTPGDAKYREKLILVVFDLKTGSLYDNQAYDAGKSLAKNLLEYYWNNGNNGGRAYIVLSIPNLAHYKLVTGFKETLKDEGHEDLLEKVGHDFSGNDDIPDIESAYKKAGVTGHVWQSDGITNCLPRTLKRVILAIANRDSGSGIINKVYYWTVDKRSTTRDSLEAGVDGIMTNYPDVIADVLSEAAYKDKYRIATYDDNPWETFKA
Expression Region: 1-273aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 34.8 kDa
Alternative Name(s):
Relevance: Catalyzes the hydrolysis of sphingomyelin. May also acts on other phosphatidyl esters. Induces complent-dependent holysis, dermonecrosis, blood vessel permeability and platelet aggregation .
Reference: Molecular evolution, functional variation, and proposed nomenclature of the gene family that includes sphingomyelinase D in sicariid spider venoms.Binford G.J., Bodner M.R., Cordes M.H., Baldwin K.L., Rynerson M.R., Burns S.N., Zobel-Thropp P.A.Mol. Biol. Evol. 26:547-566(2009)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
