Skip to product information
1 of 1

Gene Bio Systems

Recombinant Leuconostoc mesenteroides subsp. mesenteroides UPF0397 protein LEUM_1974 (LEUM_1974)

Recombinant Leuconostoc mesenteroides subsp. mesenteroides UPF0397 protein LEUM_1974 (LEUM_1974)

SKU:CSB-CF312864LFG

Regular price €1.474,95 EUR
Regular price Sale price €1.474,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523)

Uniprot NO.:Q03US7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKENNKKTGLSVRSVVATGIGAAVFFILMKYIAIPTGVPNTNVNVAEGWLALIAGLFGPV VGFLVGVIGHTITDATYGAPWWSWVLADGVFGLLLGLSKRFLDLEGGDLSTKKLVQFNVW QIIANVIAWLIVAPIGDILIYKQPASKVFLQGAAATIVNILSVAIIGSILLVAYVKSRPK KSSLRSE

Protein Names:Recommended name: UPF0397 protein LEUM_1974

Gene Names:Ordered Locus Names:LEUM_1974

Expression Region:1-187

Sequence Info:full length protein

View full details