Skip to product information
1 of 1

Gene Bio Systems

Recombinant Leiurus hebraeus Beta-mammal/insect toxin Lqhb1

Recombinant Leiurus hebraeus Beta-mammal/insect toxin Lqhb1

SKU:CSB-BP314377LDS

Regular price €1.542,95 EUR
Regular price Sale price €1.542,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Others

Uniprot ID:P0C5H3

Gene Names:N/A

Organism:Leiurus hebraeus (Deathstalker scorpion) (Leiurus quinquestriatus hebraeus)

AA Sequence:DNGYLLNKATGCKVWCVINNASCNSECKLRRGNYGYCYFWKLACYCEGAPKSELWAYATNKCNGKL

Expression Region:20-85aa

Sequence Info:Full Length of Mature Protein

Source:Baculovirus

Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW:11.5

Alternative Name(s):Lqh-beta-1

Relevance:Beta toxins bind voltage-independently at site-4 of sodium channels and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. Competes, with apparent high affinity, with anti-insect and anti-mammalian beta-toxins for binding to cockroach and rat brain synaptosomes, respectively. Also competes with an anti-mammalian alpha-toxin on binding to rat brain sodium channels. Has a weak effect on cardiac sodium channels and a marked effect on rat brain and skeletal muscle sodium channels.

Reference:"An 'Old World' scorpion beta-toxin that recognizes both insect and mammalian sodium channels." Gordon D., Ilan N., Zilberberg N., Gilles N., Urbach D., Cohen L., Karbat I., Froy O., Gaathon A., Kallen R.G., Benveniste M., Gurevitz M. Eur. J. Biochem. 270:2663-2670(2003)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:28-38 business days

View full details