Skip to product information
1 of 1

Gene Bio Systems

Recombinant Lactococcus lactis subsp. cremoris Riboflavin transporter RibU(ribU)

Recombinant Lactococcus lactis subsp. cremoris Riboflavin transporter RibU(ribU)

SKU:CSB-CF515170LNE

Regular price €1.486,95 EUR
Regular price Sale price €1.486,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Lactococcus lactis subsp. cremoris (strain NZ9000)

Uniprot NO.:D8KIE9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSKTRRMVLIAMLAALSTILLLPILQFPLLPGIDFMKVELSIIPVLIGVFTLGLGDGFII LFIRSVLWYLLFNQGPSTWIGVPMNFVALGIFMAIVWFFTKKKFSIKNYTVGIVLATIAS VLVMMVLNVFYALPLYRLAAGFDVDKIFAGATHLFNMGSLSVTLNPTYLLTVVLPFNALQ YIIFALVFGLIVTVFKKNKVVKFYNA

Protein Names:Recommended name: Riboflavin transporter RibU Alternative name(s): Riboflavin ECF transporter S component RibU

Gene Names:Name:ribU Ordered Locus Names:LLNZ_06150

Expression Region:1-206

Sequence Info:full length protein

View full details