Gene Bio Systems
Recombinant Lactococcus lactis subsp. cremoris Queuosine precursor transporter QueT(queT)
Recombinant Lactococcus lactis subsp. cremoris Queuosine precursor transporter QueT(queT)
SKU:CSB-CF381745LND
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Lactococcus lactis subsp. cremoris (strain MG1363)
Uniprot NO.:A2RM05
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKKSKTYDIVTIAIVAALYVILTMTPGLSAISYGPIQFRVSEMLNFTAFFNKKYIIAVTI GCMISNFLSFTWVDVIVGGLSTLVFLSLGVLLFDRFKEDYFWNGQLNKAFFFFAIFFSIS MFTIALELKFVAETPFLLTWGTLALGEFASLFIGAFIMDKLGKRVDLSR
Protein Names:Recommended name: Queuosine precursor transporter QueT Alternative name(s): Queuosine precursor ECF transporter S component QueT
Gene Names:Name:queT Ordered Locus Names:llmg_1760
Expression Region:1-169
Sequence Info:full length protein
