Skip to product information
1 of 1

Gene Bio Systems

Recombinant Lactococcus lactis subsp. cremoris Queuosine precursor transporter QueT(queT)

Recombinant Lactococcus lactis subsp. cremoris Queuosine precursor transporter QueT(queT)

SKU:CSB-CF381745LND

Regular price €1.451,95 EUR
Regular price Sale price €1.451,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Lactococcus lactis subsp. cremoris (strain MG1363)

Uniprot NO.:A2RM05

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKKSKTYDIVTIAIVAALYVILTMTPGLSAISYGPIQFRVSEMLNFTAFFNKKYIIAVTI GCMISNFLSFTWVDVIVGGLSTLVFLSLGVLLFDRFKEDYFWNGQLNKAFFFFAIFFSIS MFTIALELKFVAETPFLLTWGTLALGEFASLFIGAFIMDKLGKRVDLSR

Protein Names:Recommended name: Queuosine precursor transporter QueT Alternative name(s): Queuosine precursor ECF transporter S component QueT

Gene Names:Name:queT Ordered Locus Names:llmg_1760

Expression Region:1-169

Sequence Info:full length protein

View full details