Recombinant Lactobacillus fermentum  Large-conductance mechanosensitive channel(mscL)

Recombinant Lactobacillus fermentum Large-conductance mechanosensitive channel(mscL)

CSB-CF460094LMO
Regular price
€1.022,95 EUR
Sale price
€1.022,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Lactobacillus fermentum (strain NBRC 3956 / LMG 18251)

Uniprot NO.:B2GEU1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLKEFKEFIARGNVMDLAVGVIIGAAFTAIVKSLVSNLINPLIGIFLGKIDLSNLVFSIG SAHFRYGSFLNEVINFLIIAFVVFLMVKGINKVMPKKEEEAVKEGPSKEEEYLGQIVELL KKQDK

Protein Names:Recommended name: Large-conductance mechanosensitive channel

Gene Names:Name:mscL Ordered Locus Names:LAF_1837

Expression Region:1-125

Sequence Info:full length protein

Your list is ready to share