Skip to product information
1 of 1

Gene Bio Systems

Recombinant Lactobacillus casei Folate transporter FolT(folT)

Recombinant Lactobacillus casei Folate transporter FolT(folT)

SKU:CSB-CF312721LAN

Regular price €1.455,95 EUR
Regular price Sale price €1.455,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Lactobacillus casei (strain ATCC 334)

Uniprot NO.:Q035X6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQVLSFSSPKLSTRNMVYMAMLMAMQIVLGRFSFGTPWLKISPAFFATILMGYYFGPWLA AGAAALNDQLSIMIFSPGANFPGFTISAAIAAMLYGMFFHGKKVTVLRTLLAVGMVLLIS NIILTTLWLNIMGTPWQGIIWPRTIKNVVMLPIQTALSYGTLKAIERIRPHL

Protein Names:Recommended name: Folate transporter FolT Alternative name(s): Folate ECF transporter S component FolT

Gene Names:Name:folT Ordered Locus Names:LSEI_2252

Expression Region:1-172

Sequence Info:full length protein

View full details