Skip to product information
1 of 1

Gene Bio Systems

Recombinant Laccaria bicolor Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)

Recombinant Laccaria bicolor Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)

SKU:CSB-CF535830LLZ

Regular price €1.474,95 EUR
Regular price Sale price €1.474,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) (Bicoloured deceiver) (Laccaria laccata var. bicolor)

Uniprot NO.:B0D4J7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MASNTIAQSPSGAIHVPIDQGYEGWTEKFSRKFKENPWVPIGCVATCGALIMSAVKMRAG KSTDMNYWLRARVVIQGVTIAALVAGSMSLQAQRKKVEEATGVTEETKKEREKEEFESRL RGAQAAYEEEAALAGKTVKGPTVKRHVHPETGAQEREEETVERKAATLAGRQHPHPVAPV DKKPQEG

Protein Names:Recommended name: Altered inheritance of mitochondria protein 31, mitochondrial

Gene Names:Name:AIM31 ORF Names:LACBIDRAFT_293603

Expression Region:1-187

Sequence Info:full length protein

View full details