Skip to product information
1 of 1

GeneBio Systems

Recombinant JC polyomavirus Small t antigen

Recombinant JC polyomavirus Small t antigen

SKU:P03083

Regular price €844,95 EUR
Regular price Sale price €844,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P03083

Gene Names: N/A

Alternative Name(s): (ST)(ST-AG)

Abbreviation: Recombinant JC polyomavirus Small t antigen protein

Organism: JC polyomavirus (JCPyV) (JCV)

Source: E.coli

Expression Region: 1-172aa

Protein Length: Full Length

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein Sequence: MDKVLNREESMELMDLLGLDRSAWGNIPVMRKAYLKKCKELHPDKGGDEDKMKRMNFLYKKMEQGVKVAHQPDFGTWNSSEVGCDFPPNSDTLYCKEWPNCATNPSVHCPCLMCMLKLRHRNRKFLRSSPLVWIDCYCFDCFRQWFGCDLTQEALHCWEKVLGDTPYRDLKL

MW: 27.7 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Promotes efficient viral genome replication by modulating several host signaling pathways including transport network, interferon production or cell cycle progression. Inhibits host PP2A phosphatase activity and thereby prevents agnoprotein dephosphorylation. Inactivation of PP2A also results in the transactivation of cyclin A and cyclin D1 promoters. In addition, antagonizes the RIG-I/DDX58-mediated IFN response through interaction with E3 ligase TRIM25 leading to the inhibition of 'Lys-63'-linked ubiquitination of DDX58. Inhibits nucleotide excision repair (NER) pathway which leads to DNA strand breaks during DNA replication and micronuclei formation.

Reference: "The Small t Antigen of JC Virus Antagonizes RIG-I-Mediated Innate Immunity by Inhibiting TRIM25's RNA Binding Ability." Chiang C., Dvorkin S., Chiang J.J., Potter R.B., Gack M.U. MBio 12: 0-0(2021)

Function:

View full details