Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ixodes scapularis Protein KRTCAP2 homolog

Recombinant Ixodes scapularis Protein KRTCAP2 homolog

SKU:CSB-CF725169INM

Regular price €1.417,95 EUR
Regular price Sale price €1.417,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Ixodes scapularis (Black-legged tick) (Deer tick)

Uniprot NO.:Q5Q995

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAVSSGTSGMLATCLFMLLFATMQIYKSQLTSSQPMAIVGGFLGSVLFILILTAISNFET HFFGRNFQTKLIPEVVIALVIAMAASGMVHRVCITTCLIFSIVALYYVSRISIKVHGSGA GTATAIPVTKGKKGK

Protein Names:Recommended name: Protein KRTCAP2 homolog

Gene Names:

Expression Region:1-135

Sequence Info:full length protein

View full details