Gene Bio Systems
Recombinant Inner membrane protein ydgC(ydgC)
Recombinant Inner membrane protein ydgC(ydgC)
SKU:CSB-CF364876SZB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Shigella flexneri
Uniprot NO.:P0ACX2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGLVIKAALGALVVLLIGVLAKTKNYYIAGLIPLFPTFALIAHYIVASERGIEALRATII FSMWSIIPYFVYLVSLWYFTGMMRLPAAFVGSVACWGISAWVLIICWIKLH
Protein Names:Recommended name: Inner membrane protein ydgC
Gene Names:Name:ydgC Ordered Locus Names:SF1628, S1760
Expression Region:1-111
Sequence Info:full length protein
