Gene Bio Systems
Recombinant Ignicoccus hospitalis Protein CrcB homolog(crcB)
Recombinant Ignicoccus hospitalis Protein CrcB homolog(crcB)
SKU:CSB-CF422117ILH
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125)
Uniprot NO.:A8AAZ9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKALVWVAVGGALGAIVRYFFYKFVPQVYDFPLATFLVNVVASFLLGFIIGAFEAKPWGQ QLKLALATGFCGALSTFSTFAADNYILLRSSKYITAFVYTAVSVGLGIVSVALGEDLAQR LLK
Protein Names:Recommended name: Protein CrcB homolog
Gene Names:Name:crcB Ordered Locus Names:Igni_0921
Expression Region:1-123
Sequence Info:full length protein
