Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Zinc transporter ZIP1(SLC39A1),partial

Recombinant Human Zinc transporter ZIP1(SLC39A1),partial

SKU:CSB-RP179544h

Regular price €606,95 EUR
Regular price Sale price €606,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Transport

Uniprot ID: Q9NY26

Gene Names: SLC39A1

Organism: Homo sapiens (Human)

AA Sequence: MEQITLAYKEQSGPSPLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALR

Expression Region: 126-179aa

Sequence Info: Cytoplasmic Domain

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 9.6 kDa

Alternative Name(s): Solute carrier family 39 member 1Zinc-iron-regulated transporter-likeZrt- and Irt-like protein 1 ;ZIP-1 ;hZIP1

Relevance: Mediates zinc uptake. May function as a major endogenous zinc uptake transporter in many cells of the body. Responsible for the rapid uptake and accumulation of physiologically effective zinc in prostate cells.

Reference: Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C.Genome Res. 10:703-713(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details