Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Zinc transporter ZIP11 (SLC39A11), partial

Recombinant Human Zinc transporter ZIP11 (SLC39A11), partial

SKU:Q8N1S5

Regular price €673,95 EUR
Regular price Sale price €673,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Metabolism

Uniprot ID: Q8N1S5

Gene Names: SLC39A11

Alternative Name(s): (Solute carrier family 39 member 11)(Zrt- and Irt-like protein 11)(ZIP-11)

Abbreviation: Recombinant Human SLC39A11 protein, partial

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 93-193aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-GST-tagged

Target Protein Sequence: YLADLLMPHLGAAEDPQTTLALNFGSTLMKKKSDPEGPALLFPESELSIRIGRAGLLSDKSENGEAYQRKKAAATGLPEGPAVPVPSRGNLAQPGGSSWRR

MW: 42.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Functions as a cellular zinc transporter.

Reference: "Zinc transporter genes and urological cancers: integrated analysis suggests a role for ZIP11 in bladder cancer." Wu L., Chaffee K.G., Parker A.S., Sicotte H., Petersen G.M. Tumour Biol 36: 7431-7437(2015)

Function:

View full details