Gene Bio Systems
Recombinant Human Visinin-like protein 1(VSNL1)
Recombinant Human Visinin-like protein 1(VSNL1)
SKU:CSB-EP025933HU
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Signal Transduction
Uniprot ID: P62760
Gene Names: VSNL1
Organism: Homo sapiens (Human)
AA Sequence: GKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK
Expression Region: 1-191aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 49 kDa
Alternative Name(s): Hippocalcin-like protein 3
Relevance: Regulates the inhibition of rhodopsin phosphorylation in a calcium-dependent manner.
Reference: "Peptide conservation between avian and mammalian visinin-like proteins." Bellingham J. Submitted (DEC-1997)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
