Recombinant Human Vesicle-trafficking protein SEC22b(SEC22B)

SKU: CSB-CF020945HU

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O75396

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:VLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCDLVLCEAAFPKTLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSCARRNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKYRQDAKYLNMHSTYAKLAAVAVFFIMLIVYVRFWWL

Protein Names:Recommended name: Vesicle-trafficking protein SEC22b Alternative name(s): ER-Golgi SNARE of 24 kDa Short name= ERS-24 Short name= ERS24 SEC22 vesicle-trafficking protein homolog B SEC22 vesicle-trafficking protein-like 1

Gene Names:Name:SEC22B Synonyms:SEC22L1

Expression Region:2-215

Sequence Info:full length protein