Gene Bio Systems
Recombinant Human UPF0766 protein C6orf228(C6orf228)
Recombinant Human UPF0766 protein C6orf228(C6orf228)
SKU:CSB-CF319138HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:P0DJ93
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MWHSVGLTLLVFVATLLIVLLLMVCGWYFVWHLFLSKFKFLRELVGDTGSQEGDHEPSGS ETEEDTSSSPHRIRSARQRRAPADEGHRPLT
Protein Names:Recommended name: UPF0766 protein C6orf228
Gene Names:Name:C6orf228
Expression Region:1-91
Sequence Info:full length protein
