Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human UPF0197 transmembrane protein C11orf10(C11orf10)

Recombinant Human UPF0197 transmembrane protein C11orf10(C11orf10)

SKU:CSB-CF002991HU

Regular price €1.352,95 EUR
Regular price Sale price €1.352,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P61165

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV

Protein Names:Recommended name: UPF0197 transmembrane protein C11orf10

Gene Names:Name:C11orf10 ORF Names:HSPC005

Expression Region:1-79

Sequence Info:Full length protein

View full details