Gene Bio Systems
Recombinant Human UPF0197 transmembrane protein C11orf10(C11orf10)
Recombinant Human UPF0197 transmembrane protein C11orf10(C11orf10)
SKU:CSB-CF002991HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:P61165
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV
Protein Names:Recommended name: UPF0197 transmembrane protein C11orf10
Gene Names:Name:C11orf10 ORF Names:HSPC005
Expression Region:1-79
Sequence Info:Full length protein
