Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Uncharacterized protein C4orf34(C4orf34)

Recombinant Human Uncharacterized protein C4orf34(C4orf34)

SKU:CSB-CF857012HU

Regular price €1.228,95 EUR
Regular price Sale price €1.228,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q96QK8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAEGGFDPCECVCSHEHAMRRLINLLRQSQSYCTDTECLQELPGPSGDNGISVTMILVAW MVIALILFLLRPPNLRGSSLPGKPTSPHNGQDPPAPPVD

Protein Names:Recommended name: Uncharacterized protein C4orf34

Gene Names:Name:C4orf34

Expression Region:1-99

Sequence Info:full length protein

View full details