Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Tumor suppressor candidate 5(TUSC5)

Recombinant Human Tumor suppressor candidate 5(TUSC5)

SKU:CSB-CF025354HU

Regular price €1.460,95 EUR
Regular price Sale price €1.460,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q8IXB3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAHPVQSEFPSAQEPGSAAFLDLPEMEILLTKAENKDDKTLNLSKTLSGPLDLEQNSQGL PFKAISEGHLEAPLPRSPSRASSRRASSIATTSYAQDQEAPRDYLILAVVACFCPVWPLN LIPLIISIMSRSSMQQGNVDGARRLGRLARLLSITLIIMGIVIIMVAVTVNFTVQKK

Protein Names:Recommended name: Tumor suppressor candidate 5 Alternative name(s): Interferon-induced transmembrane domain-containing protein D3 Protein located at seventeen-p-thirteen point three 1

Gene Names:Name:TUSC5 Synonyms:IFITMD3, LOST1

Expression Region:1-177

Sequence Info:full length protein

View full details